The euplotid nuclear code (translation table 10) is the genetic code used by Euplotidae. The euplotid code is a socalled "symmetrical code", which results from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov, reported that "the patterns are shown to match the criteria of an intelligent signal."[1]
^shCherbak, Vladimir I.; Makukov, Maxim A. (May 2013). "The 'Wow! signal' of the terrestrial genetic code". Icarus. 224 (1): 228–242. arXiv:1303.6739. Bibcode:2013Icar..224..228S. doi:10.1016/j.icarus.2013.02.017. S2CID 16507813.
^D. C. Hoffman; R. C. Anderson; M. L. DuBois; D. M. Prescott (25 April 1995). "Macronuclear gene-sized molecules of hypotrichs". Nucleic Acids Res. 23 (8): 1279–83. doi:10.1093/nar/23.8.1279. PMC306850. PMID 7753617.
^Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 19 March 2016.
April 12, 2024
euplotid, nuclear, code, euplotid, nuclear, code, translation, table, genetic, code, used, euplotidae, euplotid, code, socalled, symmetrical, code, which, results, from, symmetrical, distribution, codons, this, symmetry, allows, arythmic, exploration, codon, d. The euplotid nuclear code translation table 10 is the genetic code used by Euplotidae The euplotid code is a socalled symmetrical code which results from the symmetrical distribution of the codons This symmetry allows for arythmic exploration of the codon distribution In 2013 shCherbak and Makukov reported that the patterns are shown to match the criteria of an intelligent signal 1 Contents 1 The code 2 Differences from the standard code 3 Systematic range 4 See also 5 ReferencesThe code edit a href Amino acid html title Amino acid AAs a FFLLSSSSYY CCCWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG a href Start codon html title Start codon Starts a M a href DNA html Nucleobase classification title DNA Base1 a TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGBases adenine A cytosine C guanine G and thymine T or uracil U Amino acids Alanine Ala A Arginine Arg R Asparagine Asn N Aspartic acid Asp D Cysteine Cys C Glutamic acid Glu E Glutamine Gln Q Glycine Gly G Histidine His H Isoleucine Ile I Leucine Leu L Lysine Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V Differences from the standard code editDNA codons RNA codons This code 10 Standard code 1 TGA UGA Cys C STOP Ter Systematic range editCiliata Euplotidae 2 See also editList of genetic codesReferences editThis article incorporates text from the United States National Library of Medicine which is in the public domain 3 shCherbak Vladimir I Makukov Maxim A May 2013 The Wow signal of the terrestrial genetic code Icarus 224 1 228 242 arXiv 1303 6739 Bibcode 2013Icar 224 228S doi 10 1016 j icarus 2013 02 017 S2CID 16507813 D C Hoffman R C Anderson M L DuBois D M Prescott 25 April 1995 Macronuclear gene sized molecules of hypotrichs Nucleic Acids Res 23 8 1279 83 doi 10 1093 nar 23 8 1279 PMC 306850 PMID 7753617 Elzanowski A Ostell J Leipe D Soussov V The Genetic Codes Taxonomy browser National Center for Biotechnology Information NCBI U S National Library of Medicine Retrieved 19 March 2016 Retrieved from https en wikipedia org w index php title Euplotid nuclear code amp oldid 1124721089, wikipedia, wiki, book, books, library,