The alternative yeast nuclear code (translation table 12) is a genetic code found in certain yeasts. However, other yeast, including Saccharomyces cerevisiae, Candida azyma, Candida diversa, Candida magnoliae, Candida rugopelliculosa, Yarrowia lipolytica, and Zygoascus hellenicus, definitely use the standard (nuclear) code.[1]
^ abT. Ohama; T. Suzuki; M. Mori; S. Osawa; T. Ueda; K. Watanabe; T. Nakase (25 August 1993). "Non-universal decoding of the leucine codon CUG in several Candida species". Nucleic Acids Res. 21 (17): 4039–45. doi:10.1093/nar/21.17.4039. PMC309997. PMID 8371978.
^M. A. Santos; G. Keith; M. F. Tuite (February 1993). "Non-standard translational events in Candida albicans mediated by an unusual seryl-tRNA with a 5'-CAG-3' (leucine) anticodon". EMBO J. 12 (2): 607–16. doi:10.1002/j.1460-2075.1993.tb05693.x. PMC413244. PMID 8440250.
^Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 19 March 2016.
This genetics article is a stub. You can help Wikipedia by expanding it.
alternative, yeast, nuclear, code, alternative, yeast, nuclear, code, translation, table, genetic, code, found, certain, yeasts, however, other, yeast, including, saccharomyces, cerevisiae, candida, azyma, candida, diversa, candida, magnoliae, candida, rugopel. The alternative yeast nuclear code translation table 12 is a genetic code found in certain yeasts However other yeast including Saccharomyces cerevisiae Candida azyma Candida diversa Candida magnoliae Candida rugopelliculosa Yarrowia lipolytica and Zygoascus hellenicus definitely use the standard nuclear code 1 Contents 1 The code 2 Differences from the standard code 3 Alternative initiation codons 4 Systematic range 5 See also 6 ReferencesThe code edit a href Amino acid html title Amino acid AAs a FFLLSSSSYY CC WLLLSPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG a href Start codon html title Start codon Starts a M M a href DNA html Nucleobase classification title DNA Base1 a TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Base2 TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG Base3 TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG Bases adenine A cytosine C guanine G and thymine T or uracil U Amino acids Alanine Ala A Arginine Arg R Asparagine Asn N Aspartic acid Asp D Cysteine Cys C Glutamic acid Glu E Glutamine Gln Q Glycine Gly G Histidine His H Isoleucine Ile I Leucine Leu L Lysine Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V Differences from the standard code editDNA codons RNA codons This code 12 Standard code 1 CTG CUG Ser S Leu L Alternative initiation codons editCAG may be used in Candida albicans 2 Systematic range editEndomycetales yeasts Candida albicans Candida cylindracea Candida melibiosica Candida parapsilosis and Candida rugosa 1 See also editList of genetic codesReferences editThis article incorporates text from the United States National Library of Medicine which is in the public domain 3 a b T Ohama T Suzuki M Mori S Osawa T Ueda K Watanabe T Nakase 25 August 1993 Non universal decoding of the leucine codon CUG in several Candida species Nucleic Acids Res 21 17 4039 45 doi 10 1093 nar 21 17 4039 PMC 309997 PMID 8371978 M A Santos G Keith M F Tuite February 1993 Non standard translational events in Candida albicans mediated by an unusual seryl tRNA with a 5 CAG 3 leucine anticodon EMBO J 12 2 607 16 doi 10 1002 j 1460 2075 1993 tb05693 x PMC 413244 PMID 8440250 Elzanowski A Ostell J Leipe D Soussov V The Genetic Codes Taxonomy browser National Center for Biotechnology Information NCBI U S National Library of Medicine Retrieved 19 March 2016 nbsp This genetics article is a stub You can help Wikipedia by expanding it vte Retrieved from https en wikipedia org w index php title Alternative yeast nuclear code amp oldid 1083583434, wikipedia, wiki, book, books, library,
