^Su AI, Wiltshire T, Batalov S, Lapp H, et al. (April 2004). "A gene atlas of the mouse and human protein-encoding transcriptomes". Proceedings of the National Academy of Sciences of the United States of America. 101 (16): 6062–7. Bibcode:2004PNAS..101.6062S. doi:10.1073/pnas.0400782101. PMC395923. PMID 15075390.
External linksedit
Human ARMCX6 genome location and ARMCX6 gene details page in the UCSC Genome Browser.
Further readingedit
Ross MT, Grafham DV, Coffey AJ, et al. (2005). "The DNA sequence of the human X chromosome". Nature. 434 (7031): 325–37. Bibcode:2005Natur.434..325R. doi:10.1038/nature03440. PMC2665286. PMID 15772651.
Strausberg RL, Feingold EA, Grouse LH, et al. (2002). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc. Natl. Acad. Sci. U.S.A. 99 (26): 16899–903. Bibcode:2002PNAS...9916899M. doi:10.1073/pnas.242603899. PMC139241. PMID 12477932.
Olsen JV, Blagoev B, Gnad F, et al. (2006). "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks". Cell. 127 (3): 635–48. doi:10.1016/j.cell.2006.09.026. PMID 17081983.
Gerhard DS, Wagner L, Feingold EA, et al. (2004). "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)". Genome Res. 14 (10B): 2121–7. doi:10.1101/gr.2596504. PMC528928. PMID 15489334.
Ota T, Suzuki Y, Nishikawa T, et al. (2004). "Complete sequencing and characterization of 21,243 full-length human cDNAs". Nat. Genet. 36 (1): 40–5. doi:10.1038/ng1285. PMID 14702039.
This article on a gene on the human X chromosome and/or its associated protein is a stub. You can help Wikipedia by expanding it.
armcx6, armadillo, repeat, containing, linked, protein, that, humans, encoded, gene, located, chromosome, identifiersaliases, gasp10, armadillo, repeat, containing, linked, armadillo, repeat, containing, linked, 6external, idsmgi, 2147993, homologene, 10373, g. Armadillo repeat containing X linked 6 is a protein that in humans is encoded by the ARMCX6 gene located on the X chromosome 5 ARMCX6IdentifiersAliasesARMCX6 GASP10 armadillo repeat containing X linked 6 armadillo repeat containing X linked 6External IDsMGI 2147993 HomoloGene 10373 GeneCards ARMCX6Gene location Human Chr X chromosome human 1 BandXq22 1Start101 615 118 bp 1 End101 618 001 bp 1 Gene location Mouse Chr X chromosome mouse 2 BandX X E3Start133 649 210 bp 2 End133 652 166 bp 2 RNA expression patternBgeeHumanMouse ortholog Top expressed inbody of pancreassmooth muscle tissueislet of Langerhansstromal cell of endometriumspleenmonocyteright coronary arterylymph nodepopliteal arterythymusTop expressed inovarylensneural tubemesencephalonhypothalamusrhombencephalonlimbganglionic eminenceadrenal glandstomachMore reference expression dataBioGPSn aOrthologsSpeciesHumanMouseEntrez54470278097EnsemblENSG00000198960ENSMUSG00000050394UniProtQ7L4S7Q8K3A6RefSeq mRNA NM 001009584NM 001184768NM 019007NM 001007578RefSeq protein NP 001009584NP 001171697NP 061880NP 001007579Location UCSC Chr X 101 62 101 62 MbChr X 133 65 133 65 MbPubMed search 3 4 WikidataView Edit HumanView Edit Mouse It is one of six armadillo repeats containing X linked proteins ARMCX1 ARMCX2 ARMCX3 ARMCX4 ARMCX5 and ARMCX6 this protein The function of this protein is unknown at this time Contents 1 Protein sequence 2 Homology 3 Orthologs 3 1 Secondary Structure 4 Expression 5 References 6 External links 7 Further readingProtein sequence edit1 MGRAREVGWM AAGLMIGAGA CYCVYKLTIG RDDSEKLEEE 41 GEEEWDDDQE LDEEEPDIWF DFETMARPWT EDGDWTEPGA 81 PGGTEDRPSG GGKANRAHPI KQRPFPYEHK NTWSAQNCKN 121 GSCVLDLSKC LFIQGKLLFA EPKDAGFPFS QDINSHLASL 161 SMARNTSPTP DPTVREALCA PDNLNASIES QGQIKMYINE 201 VCRETVSRCC NSFLQQAGLN LLISMTVINN MLAKSASDLK 241 FPLISEGSGC AKVQVLKPLM GLSEKPVLAG ELVGAQMLFS 301 FMSLFIRNGN REILLETPAPHomology editARMCX6 is conserved in many eukaryotic organisms Orthologs edittaxonomic name common name NCBI entry Percentage of sequence similarity Length AAs comments Homo sapiens Human 1 100 300 armadillo repeat containing X linked 6 Macaca mulatta Rhesus monkey 2 97 0 300 PREDICTED similar to amrmadillo repeat containing X linked 6 H sapiens like isoform 1 Equus caballus Horse 3 90 0 300 PREDICTED similar to armadillo repeat containing X linked 6 Danio rerio zebrafish 4 84 0 301 Similar to RIKEN cDNA 0610039K22 Mus musculus House Mouse 5 97 7 393 armadillo repeat containing X linked 6 H sapiens like Bos taurus cow 6 83 0 301 armadillo repeat containing X linked 6 Mus musculus Mouse 7 82 0 301 armadillo repeat containing X linked 6 Takifugu rubripes Tetradontoidea 8 66 0 818 aryl hydrocarbon receptor 2C Caenorhabditis elegans C elegans 9 50 0 332 Serpentine Receptor class H family member srh 216 Saccharomyces cerevisiae Yeast 10 70 0 910 Hul5p Gallus gallus Chicken 11 52 0 317 PREDICTED hypothetical protein Secondary Structure edit The secondary structure of ARMCX6 is predicted to be similar to cyanase A comparison of the two sequences is shown below 6 7 10 20 30 40 ARMCX6 231 MLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQM 277 1DW9 A 19 LLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKL 65 nbsp Cyanase segment having identity with ARMCX6 Expression editMicroarray data show that ARMCX6 is highly expressed during earliest stages of spermatogenesis in mice 8 9 10 References edit a b c GRCh38 Ensembl release 89 ENSG00000198960 Ensembl May 2017 a b c GRCm38 Ensembl release 89 ENSMUSG00000050394 Ensembl May 2017 Human PubMed Reference National Center for Biotechnology Information U S National Library of Medicine Mouse PubMed Reference National Center for Biotechnology Information U S National Library of Medicine Entrez Gene armadillo repeat containing SDSC Biology Workbench 2 0 CBlast service is retiring EST Profile Viewer Human EST Profile Viewer Mouse Su AI Wiltshire T Batalov S Lapp H et al April 2004 A gene atlas of the mouse and human protein encoding transcriptomes Proceedings of the National Academy of Sciences of the United States of America 101 16 6062 7 Bibcode 2004PNAS 101 6062S doi 10 1073 pnas 0400782101 PMC 395923 PMID 15075390 External links editHuman ARMCX6 genome location and ARMCX6 gene details page in the UCSC Genome Browser Further reading editRoss MT Grafham DV Coffey AJ et al 2005 The DNA sequence of the human X chromosome Nature 434 7031 325 37 Bibcode 2005Natur 434 325R doi 10 1038 nature03440 PMC 2665286 PMID 15772651 Strausberg RL Feingold EA Grouse LH et al 2002 Generation and initial analysis of more than 15 000 full length human and mouse cDNA sequences Proc Natl Acad Sci U S A 99 26 16899 903 Bibcode 2002PNAS 9916899M doi 10 1073 pnas 242603899 PMC 139241 PMID 12477932 Olsen JV Blagoev B Gnad F et al 2006 Global in vivo and site specific phosphorylation dynamics in signaling networks Cell 127 3 635 48 doi 10 1016 j cell 2006 09 026 PMID 17081983 Gerhard DS Wagner L Feingold EA et al 2004 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 10B 2121 7 doi 10 1101 gr 2596504 PMC 528928 PMID 15489334 Ota T Suzuki Y Nishikawa T et al 2004 Complete sequencing and characterization of 21 243 full length human cDNAs Nat Genet 36 1 40 5 doi 10 1038 ng1285 PMID 14702039 nbsp This article on a gene on the human X chromosome and or its associated protein is a stub You can help Wikipedia by expanding it vte Retrieved from https en wikipedia org w index php title ARMCX6 amp oldid 1167717543, wikipedia, wiki, book, books, library,
